PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AS_FDD164762.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 135aa    MW: 15624 Da    PI: 10.8423
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AS_FDD164762.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-1047871353
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
                           NR +A rs +RK  +i eLe+kv++L ae ++L  +l  l 
  Traes_7AS_FDD164762.2 47 NRQSAARSKERKMRYISELERKVQTLHAEATTLSTQLALLH 87
                           **********************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-93999IPR004827Basic-leucine zipper domain
CDDcd147038.34E-184291No hitNo description
SuperFamilySSF579592.04E-104290No hitNo description
PROSITE profilePS502179.38143100IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.7E-94694No hitNo description
PfamPF001701.9E-84687IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MHDVIRRTGK SLPRKWQLTL VSPSVRKVPN YLCLLSLHNS CDRIWANRQS AARSKERKMR  60
YISELERKVQ TLHAEATTLS TQLALLHRDT AGLSTENSEL KMRLQNVEQQ IHLQDGKVSN  120
SSYSLSFTFF VLPRM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3766771e-100AK376677.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3131F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052397.12e-36PREDICTED: probable transcription factor PosF21 isoform X2
SwissprotQ69IL45e-37RF2A_ORYSJ; Transcription factor RF2a
TrEMBLW5HJV48e-97W5HJV4_WHEAT; Uncharacterized protein
STRINGBRADI3G41817.11e-42(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1779279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.15e-35bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]